PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo14G0016600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 303aa    MW: 32395.5 Da    PI: 6.1394
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo14G0016600genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA58.31e-18210244135
             GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                      C +C+t kTp+WR gp g+ktLCnaCG++y++ +l
  Spipo14G0016600 210 CLHCNTDKTPQWRAGPMGPKTLCNACGVRYKSGRL 244
                      99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169925.7E-8114291IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011412.255204240IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-17204254IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.8E-15206241IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577165.23E-15207267No hitNo description
CDDcd002024.40E-14209257No hitNo description
PROSITE patternPS003440210235IPR000679Zinc finger, GATA-type
PfamPF003201.6E-16210244IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MDAPEHLHGS HCRSGKPQSA MEKQGKASEH FAVDDLFNFS NDDECFGGGD DFSPDTAPVS  60
SADESTVTAL DSSSNSSGND QHFSGDCRSA DACLSDGLCV PDDDIAELEW LSNFVEESFS  120
SEDPEKLQLI SGLKPSSSSS SGLPHQEAHI LGKARTKRRR PAPTCWSSRL LVISPANSCF  180
DSFSATGEPA KKKATQESDG STAAADGRKC LHCNTDKTPQ WRAGPMGPKT LCNACGVRYK  240
SGRLVPEYRP AASPTFSLSE HSNSHRKVLE LRRQKEQQSL PPHGDLHEAL ISGGPSHAGK  300
CH*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924658.11e-107PREDICTED: GATA transcription factor 12-like
SwissprotO826323e-72GATA9_ARATH; GATA transcription factor 9
TrEMBLM0SJI62e-98M0SJI6_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P31720_0015e-98(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30253178
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.14e-72GATA transcription factor 9